Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22232
Artikelname: Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22232
Hersteller Artikelnummer: A22232
Alternativnummer: ABB-A22232-100UL,ABB-A22232-20UL,ABB-A22232-500UL,ABB-A22232-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DSC, DSC1, DSC2, DSC4, CDHF3, HT-CP, Desmocollin 3
The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 1825
UniProt: Q14574
Reinheit: Affinity purification
Sequenz: EILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGK
Target-Kategorie: DSC3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cadherins,Cytoskeleton. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus, using Desmocollin 3 Rabbit pAb (A22232) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.