DiMethyl-Histone H4-K20 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A22269
- Bilder (8)
| Artikelname: | DiMethyl-Histone H4-K20 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A22269 |
| Hersteller Artikelnummer: | A22269 |
| Alternativnummer: | ABB-A22269-20UL,ABB-A22269-100UL,ABB-A22269-1000UL,ABB-A22269-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | DOT, ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, H4C16, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20 |
| Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated, this record represents the centromeric copy. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC55059] |
| Molekulargewicht: | 11kDa |
| NCBI: | 8359 |
| UniProt: | P62805 |
| Reinheit: | Affinity purification |
| Sequenz: | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Target-Kategorie: | Histone H4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|DB,1:500 - 1:1000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22269) at 1:1000 dilution. |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman small intestine tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman colon carcinoma tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedMouse liver tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman breast cancer tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
