Human TNFRSF11A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22547
- Bilder (1)
| Artikelname: | Human TNFRSF11A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22547 |
| Hersteller Artikelnummer: | A22547 |
| Alternativnummer: | ABB-A22547-100UL,ABB-A22547-20UL,ABB-A22547-500UL,ABB-A22547-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FEO, OFE, ODFR, OSTS, PDB2, RANK, CD265, OPTB7, TRANCER, LOH18CR1, TRANCE-R, Human TNFRSF11A |
| The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 66kDa |
| NCBI: | 8792 |
| UniProt: | Q9Y6Q6 |
| Reinheit: | Affinity purification |
| Sequenz: | IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP |
| Target-Kategorie: | TNFRSF11A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Immunology Inflammation,CDs,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from C2C12 cells, using Human TNFRSF11A Rabbit pAb (A22547) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
