R9AP/RGS9BP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22557
Artikelname: R9AP/RGS9BP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22557
Hersteller Artikelnummer: A22557
Alternativnummer: ABB-A22557-100UL,ABB-A22557-20UL,ABB-A22557-1000UL,ABB-A22557-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: R9AP, RGS9, PERRS, R9AP/RGS9BP
The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 388531
UniProt: Q6ZS82
Reinheit: Affinity purification
Sequenz: MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELGAAFPLHA
Target-Kategorie: RGS9BP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: G protein signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with R9AP/RGS9BP using R9AP/RGS9BP Rabbit pAb (A22557) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.