alpha-Synuclein Rabbit PolymAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A22598PM
Artikelname: alpha-Synuclein Rabbit PolymAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A22598PM
Hersteller Artikelnummer: A22598PM
Alternativnummer: ABB-A22598PM-100UL,ABB-A22598PM-20UL,ABB-A22598PM-1000UL,ABB-A22598PM-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PD1, NACP, PARK1, PARK4
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimers disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Klonalität: Monoclonal
Molekulargewicht: 14 kDa
NCBI: 6622
UniProt: P37840
Reinheit: Affinity purification
Sequenz: TKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Target-Kategorie: SNCA
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-F,1:500 - 1:2000|IHC-P,1:1000-1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease,Neurodegenerative Diseases Ma. Shipping: Ice Bag
Western blot analysis of various lysates, using alpha-Synuclein Rabbit PolymAb (A22598PM) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of various lysates, using alpha-Synuclein Rabbit PolymAb (A22598PM) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingalpha-Synuclein Rabbit PolymAb(A22598PM) at a dilution of 1:4000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman brain tissue usingalpha-Synuclein Rabbit PolymAb(A22598PM) at a dilution of 1:4000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedRat brain tissue usingalpha-Synuclein Rabbit PolymAb(A22598PM) at a dilution of 1:4000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of SH-SY5Y cells using alpha-Synuclein Rabbit PolymAb (A22598PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of Neuro-2a cells using alpha-Synuclein Rabbit PolymAb (A22598PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of frozen sections Mouse brain tissue using alpha-Synuclein Rabbit PolymAb (A22598PM, dilution 1:1000) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.