COL4A6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22673
Artikelname: COL4A6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22673
Hersteller Artikelnummer: A22673
Alternativnummer: ABB-A22673-20UL,ABB-A22673-100UL,ABB-A22673-500UL,ABB-A22673-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DFNX6, DELXq22.3, CXDELq22.3, COL4A6
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene, alpha 5 type IV collagen, so that the gene pair shares a common promoter. Deletions in the alpha 5 gene that extend into the alpha 6 gene result in diffuse leiomyomatosis accompanying the X-linked Alport syndrome caused by the deletion in the alpha 5 gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 164kDa
NCBI: 1288
UniProt: Q14031
Reinheit: Affinity purification
Sequenz: SQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL
Target-Kategorie: COL4A6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of lysates from Rat uterus, using COL4A6 Rabbit pAb (A22673) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.