Bcl9 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A22868
Artikelname: Bcl9 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A22868
Hersteller Artikelnummer: A22868
Alternativnummer: ABB-A22868-500UL,ABB-A22868-100UL,ABB-A22868-1000UL,ABB-A22868-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: LGS, Bcl9
BCL9 is associated with B-cell acute lymphoblastic leukemia. It may be a target of translocation in B-cell malignancies with abnormalities of 1q21. Its function is unknown. The overexpression of BCL9 may be of pathogenic significance in B-cell malignancies.
Klonalität: Polyclonal
Molekulargewicht: 149kDa
NCBI: 607
UniProt: O00512
Reinheit: Affinity purification
Sequenz: MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRE
Target-Kategorie: BCL9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using Bcl9 Rabbit pAb (A22868) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.