Cleaved Gasdermin B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23046
Artikelname: Cleaved Gasdermin B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23046
Hersteller Artikelnummer: A23046
Alternativnummer: ABB-A23046-1000UL,ABB-A23046-500UL,ABB-A23046-100UL,ABB-A23046-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GSDML, PP4052, GSDMB-1, PRO2521, Cleaved Gasdermin B
This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promoters results in multiple transcript variants. Additional variants have been described, but they are candidates for nonsense-mediated mRNA decay (NMD) and are unlikely to be protein-coding.
Klonalität: Polyclonal
Molekulargewicht: 18kDa/45kDa/46kDa/47kDa
NCBI: 55876
UniProt: Q8TAX9
Reinheit: Affinity purification
Sequenz: PPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHME
Target-Kategorie: GSDMB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from HT-29+NK-92, using Cleaved Gasdermin B Rabbit pAb (A23046) at 1:400 dilution. HT-29 and NK-92 cells were treated with IFNgamma (50ng/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.