OXR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23047
- Bilder (1)
| Artikelname: | OXR1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23047 |
| Hersteller Artikelnummer: | A23047 |
| Alternativnummer: | ABB-A23047-500UL,ABB-A23047-100UL,ABB-A23047-20UL,ABB-A23047-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TLDC3, CHEGDD, Nbla00307, OXR1 |
| Predicted to enable oxidoreductase activity. Predicted to be involved in response to oxidative stress. Predicted to act upstream of or within several processes, including adult walking behavior, negative regulation of neuron death, and negative regulation of peptidyl-cysteine S-nitrosylation. Predicted to be located in mitochondrion and nucleolus. Predicted to be active in nucleus. Implicated in cerebellar hyplasia/atrophy, epilepsy, and global developmental delay. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 98kDa |
| NCBI: | 55074 |
| UniProt: | Q8N573 |
| Reinheit: | Affinity purification |
| Sequenz: | RPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE |
| Target-Kategorie: | OXR1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat lung usingOXR1 Rabbit pAb (A23047) at1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:1s. |
Produktgarantie und fachkundiger Support
