CD200 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23050
- Bilder (1)
| Artikelname: | CD200 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23050 |
| Hersteller Artikelnummer: | A23050 |
| Alternativnummer: | ABB-A23050-100UL,ABB-A23050-500UL,ABB-A23050-20UL,ABB-A23050-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OX2, Mox2, CD200 |
| Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation, negative regulation of macrophage activation, and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris, aorta, bone, nervous system, and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 31kDa |
| NCBI: | 17470 |
| UniProt: | O54901 |
| Reinheit: | Affinity purification |
| Sequenz: | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG |
| Target-Kategorie: | Cd200 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CD200 Rabbit pAb (A23050) at 1:700 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
