RYR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23056
Artikelname: RYR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23056
Hersteller Artikelnummer: A23056
Alternativnummer: ABB-A23056-500UL,ABB-A23056-100UL,ABB-A23056-20UL,ABB-A23056-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CCO, KDS, MHS, RYR, MHS1, RYDR, SKRR, RYR-1, CMYP1A, CMYP1B, PPP1R137, RYR1
This gene encodes a ryanodine receptor found in skeletal muscle. The encoded protein functions as a calcium release channel in the sarcoplasmic reticulum but also serves to connect the sarcoplasmic reticulum and transverse tubule. Mutations in this gene are associated with malignant hyperthermia susceptibility, central core disease, and minicore myopathy with external ophthalmoplegia. Alternatively spliced transcripts encoding different isoforms have been described.
Klonalität: Polyclonal
Molekulargewicht: 565kDa
NCBI: 6261
UniProt: P21817
Reinheit: Affinity purification
Sequenz: KFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
Target-Kategorie: RYR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse skeletal muscle, using RYR1 Rabbit pAb (A23056) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.