ADAMTS5 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A23125
Artikelname: ADAMTS5 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A23125
Hersteller Artikelnummer: A23125
Alternativnummer: ABB-A23125-100UL,ABB-A23125-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ADMP-2, ADAM-TS5, ADAMTS-5, ADAMTS11, ADAM-TS 5, ADAMTS-11, ADAM-TS 11, ADAMTS5
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and functions as an aggrecanase that cleaves aggrecan, a major proteoglycan of cartilage, and may mediate cartilage destruction in osteoarthritis.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC59326]
Molekulargewicht: 102 kDa
NCBI: 11096
UniProt: Q9UNA0
Reinheit: Affinity purification
Sequenz: NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR
Target-Kategorie: ADAMTS5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates, using ADAMTS5 Rabbit mAb (A23125) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.