CYP39A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23146
Artikelname: CYP39A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23146
Hersteller Artikelnummer: A23146
Alternativnummer: ABB-A23146-500UL,ABB-A23146-20UL,ABB-A23146-1000UL,ABB-A23146-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is involved in the conversion of cholesterol to bile acids. Its substrates include the oxysterols 25-hydroxycholesterol, 27-hydroxycholesterol and 24-hydroxycholesterol. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 51302
UniProt: Q9NYL5
Reinheit: Affinity purification
Sequenz: MEGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSF
Target-Kategorie: CYP39A1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,Cholesterol Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates, using CYP39A1 Rabbit pAb (A23146) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.