NSD3/WHSC1L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2317
- Bilder (1)
| Artikelname: | NSD3/WHSC1L1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2317 |
| Hersteller Artikelnummer: | A2317 |
| Alternativnummer: | ABB-A2317-500UL,ABB-A2317-20UL,ABB-A2317-1000UL,ABB-A2317-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KMT3F, KMT3G, WHISTLE, WHSC1L1, pp14328, NSD3/WHSC1L1 |
| This gene is related to the Wolf-Hirschhorn syndrome candidate-1 gene and encodes a protein with PWWP (proline-tryptophan-tryptophan-proline) domains. This protein methylates histone H3 at lysine residues 4 and 27, which represses gene transcription. Two alternatively spliced variants have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 162kDa |
| NCBI: | 54904 |
| UniProt: | Q9BZ95 |
| Reinheit: | Affinity purification |
| Sequenz: | PEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKS |
| Target-Kategorie: | NSD3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NSD3/WHSC1L1 Rabbit pAb (A2317). Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Produktgarantie und fachkundiger Support
