Nlrp6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23267
Artikelname: Nlrp6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23267
Hersteller Artikelnummer: A23267
Alternativnummer: ABB-A23267-500UL,ABB-A23267-100UL,ABB-A23267-20UL,ABB-A23267-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Avr, Navr, Nalp6, Pypaf5, Non-AVR, Navr/Avr, Nlrp6
The protein encoded by this gene binds arginine-vasopressin and may be involved in the arginine-vasopressin-mediated regulation of renal salt-water balance. The encoded protein also mediates inflammatory responses in the colon to allow recovery from intestinal epithelial damage and protects against tumorigenesis and the development of colitis. Finally, this protein can increase activation of NF-kappa-B, activation of CASP1 through interaction with ASC, and cAMP accumulation.
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 101613
UniProt: Q91WS2
Reinheit: Affinity purification
Sequenz: RQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELLGPLGEPEPERARRSDTHTFNRLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGE
Target-Kategorie: Nlrp6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of lysates from Rat colon, using Nlrp6 Rabbit pAb (A23267) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.