[KD Validated] IL13 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A23415
- Bilder (1)
| Artikelname: | [KD Validated] IL13 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A23415 |
| Hersteller Artikelnummer: | A23415 |
| Alternativnummer: | ABB-A23415-500UL,ABB-A23415-100UL,ABB-A23415-1000UL,ABB-A23415-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P600, IL-13, [KD Validated] IL13 |
| This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC61007] |
| Molekulargewicht: | 16kDa |
| NCBI: | 3596 |
| UniProt: | P35225 |
| Reinheit: | Affinity purification |
| Sequenz: | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
| Target-Kategorie: | IL13 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type(WT) and IL13 knockdown (KD) MCF7 cells, using [KD Validated] IL13 Rabbit mAb (A23415) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
