[KD Validated] EGFR Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A23452
- Bilder (1)
| Artikelname: | [KD Validated] EGFR Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A23452 |
| Hersteller Artikelnummer: | A23452 |
| Alternativnummer: | ABB-A23452-20UL,ABB-A23452-1000UL,ABB-A23452-500UL,ABB-A23452-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2, FR |
| The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC56230] |
| Molekulargewicht: | 134kDa |
| NCBI: | 1956 |
| UniProt: | P00533 |
| Reinheit: | Affinity purification |
| Sequenz: | TSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVII |
| Target-Kategorie: | EGFR |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,G protein signaling,Kinase,Tyrosine kinases,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type(WT) and EGFR knockdown (KD) HeLa cells, using [KD Validated] EGFR Rabbit mAb (A23452) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
