CD335 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23655
- Bilder (1)
| Artikelname: | CD335 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23655 |
| Hersteller Artikelnummer: | A23655 |
| Alternativnummer: | ABB-A23655-100UL,ABB-A23655-20UL,ABB-A23655-500UL,ABB-A23655-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Ly94, NKp46, CD335 |
| Acts upstream of or within defense response to virus and detection of virus. Located in cell surface. Orthologous to human NCR1 (natural cytotoxicity triggering receptor 1). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 37kDa |
| NCBI: | 17086 |
| UniProt: | Q8C567 |
| Reinheit: | Affinity purification |
| Sequenz: | QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPQPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN |
| Target-Kategorie: | Ncr1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung, using CD335 Rabbit pAb (A23655) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
