CD90.1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23659
Artikelname: CD90.1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23659
Hersteller Artikelnummer: A23659
Alternativnummer: ABB-A23659-100UL,ABB-A23659-20UL,ABB-A23659-1000UL,ABB-A23659-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: T25, CD90, Thy-1, Thy1.1, Thy1.2, Thy-1.2, CD90.1
This gene encodes a glycoprotein that is anchored to the cell surface of thymocytes, neuronal and other cells through a glycosyl-phosphatidylinositol moiety. A soluble form of the encoded protein has also been detected in serum and cerebrospinal fluid. The encoded protein undergoes further processing to generate the mature protein which mediates cell-cell interactions to trigger downstream signaling pathways.
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 21838
UniProt: P01831
Reinheit: Affinity purification
Sequenz: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKS
Target-Kategorie: Thy1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using CD90.1 Rabbit pAb (A23659) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.