Ly-6A/E (Sca-1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23672
Artikelname: Ly-6A/E (Sca-1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23672
Hersteller Artikelnummer: A23672
Alternativnummer: ABB-A23672-20UL,ABB-A23672-1000UL,ABB-A23672-500UL,ABB-A23672-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TAP, Sca1, Sca-1, Ly-6A.2, Ly-6A/E, Ly-6E.1, Ly-6A/E (Sca-1)
Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system, hindlimb tendon, liver, metanephros, and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 110454
UniProt: P05533
Reinheit: Affinity purification
Sequenz: MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQ
Target-Kategorie: Ly6a
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung, using Ly6a Rabbit pAb (A23672) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.