PJVK Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A23723
Artikelname: PJVK Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A23723
Hersteller Artikelnummer: A23723
Alternativnummer: ABB-A23723-1000UL,ABB-A23723-100UL,ABB-A23723-20UL,ABB-A23723-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DFNB59, PJVK
The protein encoded by this gene is a member of the gasdermin family, a family which is found only in vertebrates. The encoded protein is required for the proper function of auditory pathway neurons. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal recessive type 59 (DFNB59).
Klonalität: Monoclonal
Molekulargewicht: 40kDa
NCBI: 494513
UniProt: Q0ZLH3
Reinheit: Affinity purification
Sequenz: KEGTHIRVNLLNHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKRMK
Target-Kategorie: PJVK
Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with PJVK using PJVK Rabbit mAb (A23723) at 1:1100 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
<,b>,WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS<,/b>,