OMA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23860
Artikelname: OMA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23860
Hersteller Artikelnummer: A23860
Alternativnummer: ABB-A23860-20UL,ABB-A23860-100UL,ABB-A23860-1000UL,ABB-A23860-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, 2010001O09Rik, OMA1
Enables metalloendopeptidase activity. Involved in several processes, including HRI-mediated signaling, proteolysis, and regulation of mitochondrion organization. Located in mitochondrial inner membrane.
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 115209
UniProt: Q96E52
Reinheit: Affinity purification
Sequenz: EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEK
Target-Kategorie: OMA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates, using OMA1 Rabbit pAb (A23860) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.