PGHS-2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24438
Artikelname: PGHS-2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24438
Hersteller Artikelnummer: A24438
Alternativnummer: ABB-A24438-20UL,ABB-A24438-100UL,ABB-A24438-500UL,ABB-A24438-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: COX2, COX-2, PHS-2, PGG/HS, PGHS-2, hCox-2, GRIPGHS
Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.
Klonalität: Polyclonal
Konzentration: WB
Molekulargewicht: 69kDa
NCBI: 5743
UniProt: P35354
Reinheit: Affinity purification
Sequenz: GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Target-Kategorie: PTGS2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Blood,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates, using PGHS-2 Rabbit pAb (A24438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.