XPO6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24463
Artikelname: XPO6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24463
Hersteller Artikelnummer: A24463
Alternativnummer: ABB-A24463-20UL,ABB-A24463-100UL,ABB-A24463-500UL,ABB-A24463-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: XPO6, EXP6, RANBP20, exportin-6
The protein encoded by this gene is a member of the importin-beta family. Members of this family are regulated by the GTPase Ran to mediate transport of cargo across the nuclear envelope. This protein has been shown to mediate nuclear export of profilin-actin complexes. A pseudogene of this gene is located on the long arm of chromosome 14. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Klonalität: Polyclonal
Molekulargewicht: 127kDa/128kDa
NCBI: 23214
UniProt: Q96QU8
Reinheit: Affinity purification
Sequenz: DIGRQDWPMFYHDFFTNILQLIQSPVTTPLGLIMLKTTSEELACPREDLSVARKEELRKLLLDQVQTVLGLLTGILETVWDKHSVTAATPPPSPTSGESGD
Target-Kategorie: XPO6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates, using XPO6 Rabbit pAb (A24463) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.