PARVA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24474
Artikelname: PARVA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24474
Hersteller Artikelnummer: A24474
Alternativnummer: ABB-A24474-100UL,ABB-A24474-20UL,ABB-A24474-500UL,ABB-A24474-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PARVA, CH-ILKBP, MXRA2, alpha-parvin
This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
Klonalität: Polyclonal
Molekulargewicht: 20kDa/42kDa
NCBI: 55742
UniProt: Q9NVD7
Reinheit: Affinity purification
Sequenz: MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKV
Target-Kategorie: PARVA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Microfilaments,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of various lysates, using PARVA Rabbit pAb (A24474) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.