MAdCAM-1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24489
Artikelname: MAdCAM-1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24489
Hersteller Artikelnummer: A24489
Alternativnummer: ABB-A24489-20UL,ABB-A24489-100UL,ABB-A24489-1000UL,ABB-A24489-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MAdCAM-1
Predicted to enable integrin binding activity involved in cell-matrix adhesion. Acts upstream of or within keratinocyte differentiation and leukocyte migration. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in eyelid, hair follicle, and hemolymphoid system. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1).
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 17123
UniProt: Q61826
Reinheit: Affinity purification
Sequenz: QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY
Target-Kategorie: Madcam1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse small intestine, using MAdCAM-1 Rabbit pAb (A24489) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.