CD144 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24490
- Bilder (1)
| Artikelname: | CD144 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24490 |
| Hersteller Artikelnummer: | A24490 |
| Alternativnummer: | ABB-A24490-100UL,ABB-A24490-20UL,ABB-A24490-500UL,ABB-A24490-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 7B4, Vec, VECD, Cd144, VEcad, VE-Cad, CD144 |
| This gene encodes a member of the cadherin family of calcium-dependent glycoproteins that mediate cell adhesion and regulate many morphogenetic events during development. The encoded preproprotein is further processed to generate a mature protein. Mice lacking the encoded protein die in utero due to vascular insufficiency, caused by increased endothelial apoptosis. Multiple distinct genes of the cadherin family, including this gene, are found on chromosome 8. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 88kDa |
| NCBI: | 12562 |
| UniProt: | P55284 |
| Reinheit: | Affinity purification |
| Sequenz: | DWIWNQMHIDEEKNESLPHYVGKIKSNVNRQNAKYVLQGEFAGKIFGVDANTGNVLAYERLDREKVSEYFLTALIVDKNTNKNLEQPSSFTVKVHDINDNWPVFSHQVFNASVPEMSAIGTSVIRVTAVDADDPTVAGHATVLYQIVKGNEYFSIDNSGLIFTKIKNLDREKQAEYKIVVETQDALGLRGESGTATVMIRLEDINDNFPVFTQSTYTFSVPEDIRVGKPLGFLTVVDPDEPQNRMTKYSIMQGEY |
| Target-Kategorie: | Cdh5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung, using CD144 Rabbit pAb (A24490) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
