TNF RII/TNFRSF1B/CD120b Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24513
- Bilder (1)
| Artikelname: | TNF RII/TNFRSF1B/CD120b Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24513 |
| Hersteller Artikelnummer: | A24513 |
| Alternativnummer: | ABB-A24513-20UL,ABB-A24513-100UL,ABB-A24513-1000UL,ABB-A24513-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p75, TNFBR, Tnfr2, CD120b, TNF-R2, TNFR80, TNFRII, Tnfr-1, TNF-R75, TNF-R-II, TNF-alphaR2, TNFalpha-R2, TNF RII/TNFRSF1B/CD120b |
| Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including negative regulation of extracellular matrix constituent secretion, regulation of nervous system development, and semi-lunar valve development. Acts upstream of or within several processes, including RNA destabilization, apoptotic signaling pathway, and negative regulation of inflammatory response. Located in membrane raft. Is expressed in several structures, including blood, dorsal aorta, extraembryonic component, genitourinary system, and liver. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism, acne, bone disease (multiple), glomerulonephritis (multiple), and lung disease (multiple). Orthologous to human TNFRSF1B (TNF receptor superfamily member 1B). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 50kDa |
| NCBI: | 21938 |
| UniProt: | P25119 |
| Reinheit: | Affinity purification |
| Sequenz: | VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG |
| Target-Kategorie: | Tnfrsf1b |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology,Apoptosis, Receptors, Receptor Processing. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from L929 cells usingTNF RII/TNFRSF1B/CD120b Rabbit pAb (A24513) at1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
