PPBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24514
Artikelname: PPBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24514
Hersteller Artikelnummer: A24514
Alternativnummer: ABB-A24514-20UL,ABB-A24514-100UL,ABB-A24514-500UL,ABB-A24514-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1, platelet basic protein
The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 5473
UniProt: P02775
Reinheit: Affinity purification
Sequenz: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Target-Kategorie: PPBP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Growth factor,Immunology & Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Chemokines,Chemokine,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with PPBP, using PPBP Rabbit pAb (A24514) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.