POLE4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24516
Artikelname: POLE4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24516
Hersteller Artikelnummer: A24516
Alternativnummer: ABB-A24516-20UL,ABB-A24516-100UL,ABB-A24516-1000UL,ABB-A24516-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: POLE4, YHHQ1, p12, DNA polymerase epsilon subunit 4
POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 56655
UniProt: Q9NR33
Reinheit: Affinity purification
Sequenz: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
Target-Kategorie: POLE4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using POLE4 Rabbit pAb (A24516) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.