CA125 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24521
- Bilder (1)
| Artikelname: | CA125 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24521 |
| Hersteller Artikelnummer: | A24521 |
| Alternativnummer: | ABB-A24521-20UL,ABB-A24521-100UL,ABB-A24521-1000UL,ABB-A24521-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MUC16, CA125, mucin-16 |
| This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 1519kDa |
| NCBI: | 94025 |
| UniProt: | Q8WXI7 |
| Reinheit: | Affinity purification |
| Sequenz: | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRP |
| Target-Kategorie: | MUC16 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CA125 Rabbit pAb (A24521) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC):U-937 Exposure time: 20s. |
Produktgarantie und fachkundiger Support
