CD134 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24523
- Bilder (1)
| Artikelname: | CD134 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24523 |
| Hersteller Artikelnummer: | A24523 |
| Alternativnummer: | ABB-A24523-100UL,ABB-A24523-20UL,ABB-A24523-1000UL,ABB-A24523-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Ox40, ACT35, CD134, Ly-70, Txgp1, TXGP1L |
| Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process, positive regulation of B cell proliferation, and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response, negative regulation of cytokine production, and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 30kDa |
| NCBI: | 22163 |
| UniProt: | P47741 |
| Reinheit: | Affinity purification |
| Sequenz: | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Target-Kategorie: | Tnfrsf4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat spleen, using CD134 Rabbit pAb (A24523) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
