SEMG1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24532
- Bilder (1)
| Artikelname: | SEMG1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24532 |
| Hersteller Artikelnummer: | A24532 |
| Alternativnummer: | ABB-A24532-20UL,ABB-A24532-100UL,ABB-A24532-1000UL,ABB-A24532-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SEMG1, CT103, SEMG, SGI, dJ172H20.2, semenogelin-1 |
| The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. This preproprotein is proteolytically processed by the prostate-specific antigen (PSA) protease to generate multiple peptide products that exhibit distinct functions. One of these peptides, SgI-29, is an antimicrobial peptide with antibacterial activity. This proteolysis process also breaks down the gel matrix and allows the spermatozoa to move more freely. This gene and another similar semenogelin gene are present in a gene cluster on chromosome 20. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 45kDa/52kDa |
| NCBI: | 6406 |
| UniProt: | P04279 |
| Reinheit: | Affinity purification |
| Sequenz: | SSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT |
| Target-Kategorie: | SEMG1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with SEMG1, using SEMG1 Rabbit pAb (A24532) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
