LACTB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24539
- Bilder (1)
| Artikelname: | LACTB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24539 |
| Hersteller Artikelnummer: | A24539 |
| Alternativnummer: | ABB-A24539-100UL,ABB-A24539-20UL,ABB-A24539-1000UL,ABB-A24539-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LACTB, G24, MRPL56, lactamase beta |
| This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa/60kDa |
| NCBI: | 114294 |
| UniProt: | P83111 |
| Reinheit: | Affinity purification |
| Sequenz: | HRIKDEVGAPGIVVGVSVDGKEVWSEGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTTRLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGK |
| Target-Kategorie: | LACTB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Cancer,Signal Transduction,Endocrine & Metabolism,Mitochondrial metabolism,Mitochondrial markers,Mitochondrial translation,Nucleotide metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat liver, using LACTB Rabbit pAb (A24539) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
