B7-H4 / B7S1 / B7x Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24542
- Bilder (1)
| Artikelname: | B7-H4 / B7S1 / B7x Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24542 |
| Hersteller Artikelnummer: | A24542 |
| Alternativnummer: | ABB-A24542-20UL,ABB-A24542-100UL,ABB-A24542-1000UL,ABB-A24542-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | VTCN1, B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1, V-set domain-containing T-cell activation inhibitor 1, B7-H4 / B7S1 / B7x |
| This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 9kDa/18kDa/20kDa/30kDa |
| NCBI: | 79679 |
| UniProt: | Q7Z7D3 |
| Reinheit: | Affinity purification |
| Sequenz: | LIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAS |
| Target-Kategorie: | VTCN1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Cancer,Cell Biology & Developmental Biology,Cell Cycle,Cell cycle inhibitors,Immunology & Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse testis, using B7-H4 / B7S1 / B7x Rabbit pAb (A24542) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
