CITED2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24662
Artikelname: CITED2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24662
Hersteller Artikelnummer: A24662
Alternativnummer: ABB-A24662-100UL,ABB-A24662-20UL,ABB-A24662-500UL,ABB-A24662-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ASD8, MRG1, VSD2, MRG-1, P35SRJ, CITED2
The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 10370
UniProt: Q99967
Reinheit: Affinity purification
Sequenz: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMG
Target-Kategorie: CITED2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Invasion and Metastasis,Endocrine Metabolism,Cardiovascular,Hypoxia. Shipping: Ice Bag
Western blot analysis of lysates from Rat testis, using CITED2 Rabbit pAb (A24662) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.