VEGFR2/KDR/Flk-1/CD309 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24671
- Bilder (1)
| Artikelname: | VEGFR2/KDR/Flk-1/CD309 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24671 |
| Hersteller Artikelnummer: | A24671 |
| Alternativnummer: | ABB-A24671-500UL,ABB-A24671-20UL,ABB-A24671-100UL,ABB-A24671-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | orv, Flk1, Ly73, Flk-1, Krd-1, VEGFR2, VEGFR-2, sVEGFR-2, 6130401C07, VEGFR2/KDR/Flk-1/CD309 |
| Enables growth factor binding activity and vascular endothelial growth factor-activated receptor activity. Involved in several processes, including circulatory system development, peptidyl-tyrosine autophosphorylation, and positive regulation of vasculogenesis. Acts upstream of or within several processes, including animal organ development, positive regulation of cell population proliferation, and vasculature development. Located in several cellular components, including cell junction, endosome, and external side of plasma membrane. Is expressed in several structures, including alimentary system, cardiovascular system, central nervous system, extraembryonic component, and genitourinary system. Human ortholog(s) of this gene implicated in several diseases, including adhesions of uterus, artery disease (multiple), gastrointestinal system cancer (multiple), macular degeneration (multiple), and pancreatic cancer (multiple). Orthologous to human KDR (kinase insert domain receptor). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 150kDa |
| NCBI: | 16542 |
| UniProt: | P35918 |
| Reinheit: | Affinity purification |
| Sequenz: | ASVGLPGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKI |
| Target-Kategorie: | VEGFR-2,Kdr |
| Application Verdünnung: | WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Growth Factors, VEGF VEGF Receptors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung, using VEGFR2/KDR/Flk-1/CD309 Rabbit pAb (A24671) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
