ACSL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24751
Artikelname: ACSL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24751
Hersteller Artikelnummer: A24751
Alternativnummer: ABB-A24751-100UL,ABB-A24751-20UL,ABB-A24751-1000UL,ABB-A24751-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACSL1, ACS1, FACL1, FACL2, LACS, LACS1, LACS2, long-chain-fatty-acid--CoA ligase 1
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 76kDa/77kDa
NCBI: 2180
UniProt: P33121
Reinheit: Affinity purification
Sequenz: GESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV
Target-Kategorie: ACSL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from RAW 264.7 cells usingACSL1 Rabbit pAb (A24751) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.