AGPAT4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24767
Artikelname: AGPAT4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24767
Hersteller Artikelnummer: A24767
Alternativnummer: ABB-A24767-100UL,ABB-A24767-20UL,ABB-A24767-500UL,ABB-A24767-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LPAAT4, LPLAT4, 1-AGPAT4, dJ473J16.2, LPAAT-delta, AGPAT4
This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 56895
UniProt: Q9NRZ5
Reinheit: Affinity purification
Sequenz: CSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
Target-Kategorie: AGPAT4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction, Metabolism, Lipid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain usingAGPAT4 Rabbit pAb (A24767) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.