TOMM40L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24771
Artikelname: TOMM40L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24771
Hersteller Artikelnummer: A24771
Alternativnummer: ABB-A24771-20UL,ABB-A24771-100UL,ABB-A24771-1000UL,ABB-A24771-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TOMM40B, TOMM40L
Predicted to enable protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Part of protein-containing complex.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 84134
UniProt: Q969M1
Reinheit: Affinity purification
Sequenz: MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGD
Target-Kategorie: TOMM40L
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics and nuclear signaling, DNA/RNA translation, Signal transduction, metabolism, mitochondria. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingTOMM40L Rabbit pAb (A24771) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.