FDX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24786
Artikelname: FDX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24786
Hersteller Artikelnummer: A24786
Alternativnummer: ABB-A24786-20UL,ABB-A24786-100UL,ABB-A24786-500UL,ABB-A24786-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FDX1, ADX, FDX, LOH11CR1D, ferredoxin 1
This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 2230
UniProt: P10109
Reinheit: Affinity purification
Sequenz: SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSM
Target-Kategorie: FDX1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction, Growth Factors/Hormones, Hormones. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis usingFDX1 Rabbit pAb (A24786) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.