PP2A-Abeta/PR65beta/PPP2R1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24836
Artikelname: PP2A-Abeta/PR65beta/PPP2R1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24836
Hersteller Artikelnummer: A24836
Alternativnummer: ABB-A24836-100UL,ABB-A24836-20UL,ABB-A24836-500UL,ABB-A24836-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PPP2R1B, PP2A-Abeta, PR65B, protein phosphatase 2 scaffold subunit Abeta, PP2A-Abeta/PR65beta/PPP2R1B
This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes a beta isoform of the constant regulatory subunit A. Mutations in this gene have been associated with some lung and colon cancers. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 52kDa/61kDa/66kDa/73kDa
NCBI: 5519
UniProt: P30154
Reinheit: Affinity purification
Sequenz: ANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA
Target-Kategorie: PPP2R1B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology & Developmental Biology,Apoptosis,Cell Cycle,Centromere,Wnt/beta-Catenin Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen usingPP2A-Abeta/PR65beta/PPP2R1B Rabbit pAb (A24836) at1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.