SYT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24840
Artikelname: SYT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24840
Hersteller Artikelnummer: A24840
Alternativnummer: ABB-A24840-100UL,ABB-A24840-20UL,ABB-A24840-1000UL,ABB-A24840-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SYT1, P65, SVP65, SYT, synaptotagmin-1
The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 6857
UniProt: P21579
Reinheit: Affinity purification
Sequenz: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKN
Target-Kategorie: SYT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Neuroscience,Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain usingSYT1 Rabbit pAb (A24840) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.