Purinergic Receptor P2Y6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2485
Artikelname: Purinergic Receptor P2Y6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2485
Hersteller Artikelnummer: A2485
Alternativnummer: ABB-A2485-100UL,ABB-A2485-20UL,ABB-A2485-1000UL,ABB-A2485-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P2Y6, Purinergic Receptor P2Y6
The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor, which is a G-protein coupled receptor, is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. It is proposed that this receptor mediates inflammatory responses. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 5031
UniProt: Q15077
Reinheit: Affinity purification
Sequenz: GFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
Target-Kategorie: P2RY6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung, using Purinergic Receptor P2Y6 Rabbit pAb (A2485) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.