MDA5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24868
- Bilder (1)
| Artikelname: | MDA5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24868 |
| Hersteller Artikelnummer: | A24868 |
| Alternativnummer: | ABB-A24868-20UL,ABB-A24868-100UL,ABB-A24868-500UL,ABB-A24868-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1, interferon induced with helicase C domain 1 |
| DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents, treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25 kDa/117 kDa |
| NCBI: | 64135 |
| UniProt: | Q9BYX4 |
| Reinheit: | Affinity purification |
| Sequenz: | SNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS |
| Target-Kategorie: | IFIH1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Cell Biology & Developmental Biology,Apoptosis,Immunology & Inflammation,Cytokines,Interferons,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from THP-1 cells usingMDA5 Rabbit pAb (A24868) at1:1000 dilution. THP-1 cells were treated with LPS (1 µg/ml) at 37°C for 24 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:5 s. |
Produktgarantie und fachkundiger Support
