[KD Validated] RGAP1 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A24948
- Bilder (8)
| Artikelname: | [KD Validated] RGAP1 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A24948 |
| Hersteller Artikelnummer: | A24948 |
| Alternativnummer: | ABB-A24948-100UL,ABB-A24948-20UL,ABB-A24948-500UL,ABB-A24948-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CYK4, CDAN3B, ID-GAP, HsCYK-4, MgcRacGAP, [KD Validated] RGAP1 |
| This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC57331] |
| Molekulargewicht: | 71kDa |
| NCBI: | 29127 |
| UniProt: | Q9H0H5 |
| Reinheit: | Affinity purification |
| Sequenz: | SLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK |
| Target-Kategorie: | RACGAP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:2000 - 1:12000|IHC-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Immunology Inflammation,Cytokines. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates, using [KD Validated] RGAP1 Rabbit mAb (A24948) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human testis tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] RGAP1 Rabbit mAb (A24948) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
