CBX7 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A25023
Artikelname: CBX7 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A25023
Hersteller Artikelnummer: A25023
Alternativnummer: ABB-A25023-20UL,ABB-A25023-100UL,ABB-A25023-1000UL,ABB-A25023-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: CBX7
This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells.
Klonalität: Polyclonal
Konzentration: WB
Molekulargewicht: 28kDa
NCBI: 23492
UniProt: O95931
Reinheit: Affinity purification
Sequenz: NLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Target-Kategorie: CBX7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag
Western blot analysis of various lysates using CBX7 Rabbit pAb (A25023) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.