ACAA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25034
Artikelname: ACAA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25034
Hersteller Artikelnummer: A25034
Alternativnummer: ABB-A25034-100UL,ABB-A25034-20UL,ABB-A25034-1000UL,ABB-A25034-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ACAA, THIO, PTHIO, Lnc-Myd88, ACAA1
This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 30
UniProt: P09110
Reinheit: Affinity purification
Sequenz: AARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVV
Target-Kategorie: ACAA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingACAA1 Rabbit pAb (A25034) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.