Il15ra Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25036
Artikelname: Il15ra Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25036
Hersteller Artikelnummer: A25036
Alternativnummer: ABB-A25036-100UL,ABB-A25036-20UL,ABB-A25036-500UL,ABB-A25036-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IL-15RA, Il15ra
Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system, retina, retina inner nuclear layer, and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 16169
UniProt: Q60819
Reinheit: Affinity purification
Sequenz: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHY
Target-Kategorie: Il15ra
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology, Apoptosis, Receptors, Associated Proteins. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingIl15ra Rabbit pAb (A25036) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.