DKK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2562
- Bilder (1)
| Artikelname: | DKK1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2562 |
| Hersteller Artikelnummer: | A2562 |
| Alternativnummer: | ABB-A2562-1000UL,ABB-A2562-100UL,ABB-A2562-20UL,ABB-A2562-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SK, DKK-1, DKK1 |
| This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 29kDa |
| NCBI: | 22943 |
| UniProt: | O94907 |
| Reinheit: | Affinity purification |
| Sequenz: | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Target-Kategorie: | DKK1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Wnt -Catenin Signaling Pathway,Immunology Inflammation,Stem Cells,Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DKK1 Rabbit pAb (A2562) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
